SCOPe 2.05: Domain d3zrsa2: 3zrs A:139-300

Lineage for d3zrsa2 (3zrs A:139-300)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (4 PDB entries)

8. Domain d3zrsa2: 3zrs A:139-300 [250823]
   Other proteins in same PDB: d3zrsa1
   automated match to d2wlka2
   complexed with cl, k

Details for d3zrsa2

PDB Entry: 3zrs, 3.05 Å

PDB Description: X-ray crystal structure of a KirBac potassium channel highlights a mechanism of channel opening at the bundle-crossing gate.

PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d3zrsa2:

Sequence, based on SEQRES records:

>d3zrsa2 b.1.18.16 (A:139-300) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh

Sequence, based on observed residues (ATOM records):

>d3zrsa2 b.1.18.16 (A:139-300) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttgrraldlgkfheiaqhhhhh

Timeline for d3zrsa2:

• d3zrsa2 first appeared in SCOPe 2.04
  
• d3zrsa2 appears in SCOPe 2.06
  
• d3zrsa2 appears in the current release, SCOPe 2.08