SCOPe 2.08: Domain d3vklb1: 3vkl B:3-154

Lineage for d3vklb1 (3vkl B:3-154)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)

8. Domain d3vklb1: 3vkl B:3-154 [250570]
   automated match to d3ap6d_
   complexed with edo; mutant

Details for d3vklb1

PDB Entry: 3vkl, 2.55 Å

PDB Description: protease-resistant mutant form of human galectin-8 in complex with two lactose molecules

PDB Compounds: (B:) Galectin-8

SCOPe Domain Sequences for d3vklb1:

Sequence; same for both SEQRES and ATOM records:

>d3vklb1 b.29.1.0 (B:3-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradv
afhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkh
tllyghrigpekidtlgiygkvnihsigfsfs

Timeline for d3vklb1:

• d3vklb1 first appeared in SCOPe 2.04
  
• d3vklb1 appears in SCOPe 2.07