Lineage for d1d1ke_ (1d1k E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123908Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 1123909Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1124222Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 1124229Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)
  8. 1124259Domain d1d1ke_: 1d1k E: [25034]

Details for d1d1ke_

PDB Entry: 1d1k (more details), 2 Å

PDB Description: mutated shiga-like toxin b subunit (d17e/w34a) complexed with receptor gb3 analogue
PDB Compounds: (E:) shiga-like toxin I subunit b

SCOPe Domain Sequences for d1d1ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ke_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1d1ke_:

Click to download the PDB-style file with coordinates for d1d1ke_.
(The format of our PDB-style files is described here.)

Timeline for d1d1ke_: