Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187259] (19 PDB entries) |
Domain d3tkse_: 3tks E: [249948] automated match to d1qmva_ complexed with per |
PDB Entry: 3tks (more details), 2.4 Å
SCOPe Domain Sequences for d3tkse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tkse_ c.47.1.10 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse tiipdpagklkyfdkln
Timeline for d3tkse_:
View in 3D Domains from other chains: (mouse over for more information) d3tksa_, d3tksb_, d3tksc_, d3tksd_ |