SCOPe 2.06: Domain d3tkse_: 3tks E:

Lineage for d3tkse_ (3tks E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187259] (19 PDB entries)

8. Domain d3tkse_: 3tks E: [249948]
   automated match to d1qmva_
   complexed with per

Details for d3tkse_

PDB Entry: 3tks, 2.4 Å

PDB Description: Crystal structure of full-length human peroxiredoxin 4 in three different redox states

PDB Compounds: (E:) Peroxiredoxin-4

SCOPe Domain Sequences for d3tkse_:

Sequence; same for both SEQRES and ATOM records:

>d3tkse_ c.47.1.10 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
tiipdpagklkyfdkln

Timeline for d3tkse_:

• d3tkse_ first appeared in SCOPe 2.04
  
• d3tkse_ appears in SCOPe 2.05
  
• d3tkse_ appears in SCOPe 2.07
  
• d3tkse_ appears in the current release, SCOPe 2.08