Lineage for d3tkse_ (3tks E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853871Protein automated matches [190100] (17 species)
    not a true protein
  7. 1854045Species Human (Homo sapiens) [TaxId:9606] [187259] (17 PDB entries)
  8. 1854079Domain d3tkse_: 3tks E: [249948]
    automated match to d1qmva_
    complexed with per

Details for d3tkse_

PDB Entry: 3tks (more details), 2.4 Å

PDB Description: Crystal structure of full-length human peroxiredoxin 4 in three different redox states
PDB Compounds: (E:) Peroxiredoxin-4

SCOPe Domain Sequences for d3tkse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tkse_ c.47.1.10 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
tiipdpagklkyfdkln

SCOPe Domain Coordinates for d3tkse_:

Click to download the PDB-style file with coordinates for d3tkse_.
(The format of our PDB-style files is described here.)

Timeline for d3tkse_: