Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries) |
Domain d3se6a4: 3se6 A:638-961 [249388] Other proteins in same PDB: d3se6a1, d3se6a2, d3se6a3, d3se6b1, d3se6b2, d3se6b3 automated match to d2yd0a4 complexed with lys, mes, nag, zn |
PDB Entry: 3se6 (more details), 3.08 Å
SCOPe Domain Sequences for d3se6a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3se6a4 a.118.1.0 (A:638-961) automated matches {Human (Homo sapiens) [TaxId: 9606]} hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet itknikwleknlptlrtwlmvntr
Timeline for d3se6a4:
View in 3D Domains from other chains: (mouse over for more information) d3se6b1, d3se6b2, d3se6b3, d3se6b4 |