SCOPe 2.05: Domain d3se6b1: 3se6 B:55-271

Lineage for d3se6b1 (3se6 B:55-271)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255964] (11 PDB entries)

8. Domain d3se6b1: 3se6 B:55-271 [249389]
   Other proteins in same PDB: d3se6a2, d3se6a3, d3se6a4, d3se6b2, d3se6b3, d3se6b4
   automated match to d2yd0a1
   complexed with lys, mes, nag, zn

Details for d3se6b1

PDB Entry: 3se6, 3.08 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2

PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d3se6b1:

Sequence, based on SEQRES records:

>d3se6b1 b.98.1.0 (B:55-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd
leitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgd
gfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhials
nmpkvktielegglledhfettvkmstylvayivcdf

Sequence, based on observed residues (ATOM records):

>d3se6b1 b.98.1.0 (B:55-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd
leitnatlqsepgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfyk
styrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvkt
ielegglledhfettvkmstylvayivcdf

Timeline for d3se6b1:

• d3se6b1 first appeared in SCOPe 2.04
  
• d3se6b1 appears in SCOPe 2.06
  
• d3se6b1 appears in the current release, SCOPe 2.08