Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
Protein Biotin carboxylase (BC), domain 2 [56068] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
Species Escherichia coli [TaxId:562] [56069] (24 PDB entries) |
Domain d3rv3b2: 3rv3 B:115-330 [249231] Other proteins in same PDB: d3rv3a1, d3rv3a3, d3rv3b1, d3rv3b3, d3rv3b4 automated match to d1dv2a3 complexed with adp, mg |
PDB Entry: 3rv3 (more details), 1.91 Å
SCOPe Domain Sequences for d3rv3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rv3b2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq vehpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d3rv3b2: