Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries) |
Domain d3r8qa1: 3r8q A:1-92 [249064] automated match to d1fnfa2 |
PDB Entry: 3r8q (more details), 2.4 Å
SCOPe Domain Sequences for d3r8qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r8qa1 b.1.2.0 (A:1-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} aipaptdlkftqvtptslsaqwtppnvqltgyrvrvtpkektgpmkeinlapdsssvvvs glmvatkyevsvyalkdtltsrpaqgvvttle
Timeline for d3r8qa1: