Lineage for d3r8qa2 (3r8q A:93-182)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2372249Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2372250Protein automated matches [190976] (5 species)
    not a true protein
  7. 2372274Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries)
  8. 2372301Domain d3r8qa2: 3r8q A:93-182 [249065]
    automated match to d1fnfa1

Details for d3r8qa2

PDB Entry: 3r8q (more details), 2.4 Å

PDB Description: Structure of Fibronectin domain 12-14
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d3r8qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r8qa2 b.1.2.0 (A:93-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvspprrarvtdatettitiswrtktetitgfqvdavpangqtpiqrtikpdvrsytitg
lqpgtdykiylytlndnarsspvvidasta

SCOPe Domain Coordinates for d3r8qa2:

Click to download the PDB-style file with coordinates for d3r8qa2.
(The format of our PDB-style files is described here.)

Timeline for d3r8qa2: