Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Fibronectin, different Fn3 modules [49270] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries) |
Domain d1fnfa2: 1fnf A:1236-1326 [21973] repeats 7 through 10 |
PDB Entry: 1fnf (more details), 2 Å
SCOPe Domain Sequences for d1fnfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} vppptdlrftnigpdtmrvtwapppsidltnflvryspvkneedvaelsispsdnavvlt nllpgteyvvsvssvyeqhestplrgrqktg
Timeline for d1fnfa2: