Lineage for d3r24b1 (3r24 B:10-129)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038801Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
    binds two zinc ion per subunit; forms a dodecameric shell
  4. 3038802Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) (S)
    automatically mapped to Pfam PF09401
  5. 3038803Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
    partly covered by PfamB PB001266
  6. 3038868Protein automated matches [191249] (3 species)
    not a true protein
  7. 3038871Species SARS coronavirus [TaxId:227859] [189770] (4 PDB entries)
  8. 3038873Domain d3r24b1: 3r24 B:10-129 [249019]
    Other proteins in same PDB: d3r24a_, d3r24b2
    automated match to d2xyqb_
    complexed with sam, zn

Details for d3r24b1

PDB Entry: 3r24 (more details), 2 Å

PDB Description: crystal structure of nsp10/nsp16 complex of sars coronavirus
PDB Compounds: (B:) Non-structural protein 10 and Non-structural protein 11

SCOPe Domain Sequences for d3r24b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r24b1 g.86.1.1 (B:10-129) automated matches {SARS coronavirus [TaxId: 227859]}
nstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfg
gascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs

SCOPe Domain Coordinates for d3r24b1:

Click to download the PDB-style file with coordinates for d3r24b1.
(The format of our PDB-style files is described here.)

Timeline for d3r24b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r24b2
View in 3D
Domains from other chains:
(mouse over for more information)
d3r24a_