Class g: Small proteins [56992] (100 folds) |
Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily) binds two zinc ion per subunit; forms a dodecameric shell |
Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) automatically mapped to Pfam PF09401 |
Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins) partly covered by PfamB PB001266 |
Protein automated matches [191249] (3 species) not a true protein |
Species SARS coronavirus [TaxId:227859] [189770] (4 PDB entries) |
Domain d3r24b1: 3r24 B:10-129 [249019] Other proteins in same PDB: d3r24a_, d3r24b2 automated match to d2xyqb_ complexed with sam, zn |
PDB Entry: 3r24 (more details), 2 Å
SCOPe Domain Sequences for d3r24b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r24b1 g.86.1.1 (B:10-129) automated matches {SARS coronavirus [TaxId: 227859]} nstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfg gascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs
Timeline for d3r24b1: