PDB entry 3r24

View 3r24 on RCSB PDB site
Description: Crystal structure of nsp10/nsp16 complex of SARS coronavirus" if possible
Class: Transferase, Viral Protein
Keywords: Methyltransferase, zinc-finger, Transferase, Viral Protein
Deposited on 2011-03-13, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2'-O-methyl transferase
    Species: SARS coronavirus [TaxId:227859]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Non-structural protein 10 and Non-structural protein 11
    Species: SARS coronavirus [TaxId:227859]
    Gene: 1a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U8 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.07: d3r24b1, d3r24b2
  • Heterogens: SAM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r24B (B:)
    mgsdkihhhhhhnstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitv
    tpeanmdqesfggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvc
    tvcgmwkgygcscdqlreplmqsadastflngfav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r24B (B:)
    hnstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesf
    ggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygc
    s