SCOPe 2.06: Domain d3p2db1: 3p2d B:6-176

Lineage for d3p2db1 (3p2d B:6-176)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [231496] (3 PDB entries)

8. Domain d3p2db1: 3p2d B:6-176 [248406]
   automated match to d2wtrb1

Details for d3p2db1

PDB Entry: 3p2d, 3 Å

PDB Description: Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding between two non-visual subtypes

PDB Compounds: (B:) Beta-arrestin-2

SCOPe Domain Sequences for d3p2db1:

Sequence; same for both SEQRES and ATOM records:

>d3p2db1 b.1.18.0 (B:6-176) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gtrvfkksspnckltvylgkrdfvdhldkvdpvdgvvlvdpdylkdrkvfvtltcafryg
redldvlglsfrkdlfianyqafpptpnpprpptrlqerllrklgqhahpffftipqnlp
csvtlqpgpedtgkacgvdfeirafcaksleekshkrnsvrlvirkvqfap

Timeline for d3p2db1:

• d3p2db1 first appeared in SCOPe 2.04
  
• d3p2db1 appears in SCOPe 2.05
  
• d3p2db1 appears in SCOPe 2.07
  
• d3p2db1 appears in the current release, SCOPe 2.08