PDB entry 3p2d

View 3p2d on RCSB PDB site
Description: Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding between two non-visual subtypes
Class: signaling protein
Keywords: arrestin, signal transduction, cytosol, SIGNALING PROTEIN
Deposited on 2010-10-01, released 2011-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.223
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-arrestin-2
    Species: Bos taurus [TaxId:9913]
    Gene: ARRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p2da1, d3p2da2
  • Chain 'B':
    Compound: Beta-arrestin-2
    Species: Bos taurus [TaxId:9913]
    Gene: ARRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p2db1, d3p2db2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p2dA (A:)
    mgekpgtrvfkksspnckltvylgkrdfvdhldkvdpvdgvvlvdpdylkdrkvfvtltc
    afrygredldvlglsfrkdlfianyqafpptpnpprpptrlqerllrklgqhahpfffti
    pqnlpcsvtlqpgpedtgkacgvdfeirafcaksleekshkrnsvrlvirkvqfapekpg
    pqpsaettrhflmsdrslhleasldkelyyhgeplnvnvhvtnnstktvkkikvsvrqya
    diclfstaqykcpvaqveqddqvspsstfckvytitpllsnnrekrglaldgklkhedtn
    lasstivkegankevlgilvsyrvkvklvvsrggdvsvelpfvlmhpkphdhialprpqs
    aapetdapvdtnliefetnyatdddivfedfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2dA (A:)
    gtrvfkksspnckltvylgkrdfvdhldkvdpvdgvvlvdpdylkdrkvfvtltcafryg
    redldvlglsfrkdlfianyqafpptpnpprpptrlqerllrklgqhahpffftipqnlp
    csvtlqpgpedtgkacgvdfeirafcaksleekshkrnsvrlvirkvqfapekpgpqpsa
    ettrhflmsdrslhleasldkelyyhgeplnvnvhvtnnstktvkkikvsvrqyadiclf
    staqykcpvaqveqddqvspsstfckvytitpllsnnrekrglaldgklkhedtnlasst
    ivkegankevlgilvsyrvkvklvvsrggdvsvelpfvlmhpkphdivfedfar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p2dB (B:)
    mgekpgtrvfkksspnckltvylgkrdfvdhldkvdpvdgvvlvdpdylkdrkvfvtltc
    afrygredldvlglsfrkdlfianyqafpptpnpprpptrlqerllrklgqhahpfffti
    pqnlpcsvtlqpgpedtgkacgvdfeirafcaksleekshkrnsvrlvirkvqfapekpg
    pqpsaettrhflmsdrslhleasldkelyyhgeplnvnvhvtnnstktvkkikvsvrqya
    diclfstaqykcpvaqveqddqvspsstfckvytitpllsnnrekrglaldgklkhedtn
    lasstivkegankevlgilvsyrvkvklvvsrggdvsvelpfvlmhpkphdhialprpqs
    aapetdapvdtnliefetnyatdddivfedfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2dB (B:)
    gtrvfkksspnckltvylgkrdfvdhldkvdpvdgvvlvdpdylkdrkvfvtltcafryg
    redldvlglsfrkdlfianyqafpptpnpprpptrlqerllrklgqhahpffftipqnlp
    csvtlqpgpedtgkacgvdfeirafcaksleekshkrnsvrlvirkvqfapekpgpqpsa
    ettrhflmsdrslhleasldkelyyhgeplnvnvhvtnnstktvkkikvsvrqyadiclf
    staqykcpvaqveqddqvspsstfckvytitpllsnnrekrglaldgklkhedtnlasst
    ivkegankevlgilvsyrvkvklvvsrggdvsvelpfvlmhpkdivfedfar