Lineage for d3o7ba_ (3o7b A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884654Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1884655Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1884797Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 1884798Protein automated matches [190961] (13 species)
    not a true protein
  7. 1884805Species Archaeoglobus fulgidus [TaxId:2234] [255990] (1 PDB entry)
  8. 1884806Domain d3o7ba_: 3o7b A: [248124]
    automated match to d3bbda1
    complexed with sah, tyr

Details for d3o7ba_

PDB Entry: 3o7b (more details), 1.45 Å

PDB Description: crystal structure of archaeoglobus fulgidus nep1 bound to s- adenosylhomocysteine
PDB Compounds: (A:) Ribosome biogenesis Nep1 RNA methyltransferase

SCOPe Domain Sequences for d3o7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o7ba_ c.116.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mgsafvfleaslelipqkirghpavradairrgkrpekillddskhhtamkslefrekrg
rpdivhqcllllldsplrdfevyvhtlngeiiwvnretrlprnynrfvglmeklfeerri
tagdttliefkdvglrdivrgrdvllfrekggrfefselldgdvavcigafphgdffeet
lrelgefkevslgtesytslyvtsrvlceyervrah

SCOPe Domain Coordinates for d3o7ba_:

Click to download the PDB-style file with coordinates for d3o7ba_.
(The format of our PDB-style files is described here.)

Timeline for d3o7ba_: