SCOPe 2.05: Domain d1hdya1: 1hdy A:1-162,A:339-374

Lineage for d1hdya1 (1hdy A:1-162,A:339-374)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d1hdya1: 1hdy A:1-162,A:339-374 [24723]
   Other proteins in same PDB: d1hdya2, d1hdyb2
   complexed with cl, nad, pyz, zn

Details for d1hdya1

PDB Entry: 1hdy, 2.5 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1hdya1:

Sequence; same for both SEQRES and ATOM records:

>d1hdya1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgichtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf

Timeline for d1hdya1:

• d1hdya1 first appeared (with stable ids) in SCOP 1.55
  
• d1hdya1 appears in SCOPe 2.04
  
• d1hdya1 appears in SCOPe 2.06
  
• d1hdya1 appears in the current release, SCOPe 2.08