Lineage for d1hdya1 (1hdy A:1-162,A:339-374)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538001Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1538002Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1538123Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1538141Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 1538244Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 1538277Domain d1hdya1: 1hdy A:1-162,A:339-374 [24723]
    Other proteins in same PDB: d1hdya2, d1hdyb2
    complexed with cl, nad, pyz, zn

Details for d1hdya1

PDB Entry: 1hdy (more details), 2.5 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1hdya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdya1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgichtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf

SCOPe Domain Coordinates for d1hdya1:

Click to download the PDB-style file with coordinates for d1hdya1.
(The format of our PDB-style files is described here.)

Timeline for d1hdya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdya2