Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.0: automated matches [191499] (1 protein) not a true family |
Protein automated matches [190815] (10 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:1772] [232037] (2 PDB entries) |
Domain d3jz6b_: 3jz6 B: [247073] automated match to d3dtga_ complexed with gol, plp |
PDB Entry: 3jz6 (more details), 1.9 Å
SCOPe Domain Sequences for d3jz6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jz6b_ e.17.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]} leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma rln
Timeline for d3jz6b_: