Lineage for d3jz6b_ (3jz6 B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573229Species Mycobacterium smegmatis [TaxId:1772] [232037] (3 PDB entries)
  8. 2573233Domain d3jz6b_: 3jz6 B: [247073]
    automated match to d3dtga_
    complexed with gol, plp

Details for d3jz6b_

PDB Entry: 3jz6 (more details), 1.9 Å

PDB Description: crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom.
PDB Compounds: (B:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d3jz6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jz6b_ e.17.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp
saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq
liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs
vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn
lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage
itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma
rln

SCOPe Domain Coordinates for d3jz6b_:

Click to download the PDB-style file with coordinates for d3jz6b_.
(The format of our PDB-style files is described here.)

Timeline for d3jz6b_: