Lineage for d1ldya1 (1ldy A:1-163,A:340-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785523Species Horse (Equus caballus) [TaxId:9796] [50138] (53 PDB entries)
    Uniprot P00327
  8. 2785620Domain d1ldya1: 1ldy A:1-163,A:340-374 [24695]
    Other proteins in same PDB: d1ldya2, d1ldyb2, d1ldyc2, d1ldyd2
    complexed with cxf, nad, zn

Details for d1ldya1

PDB Entry: 1ldy (more details), 2.5 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and cyclohexyl formamide (cxf)
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1ldya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldya1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d1ldya1:

Click to download the PDB-style file with coordinates for d1ldya1.
(The format of our PDB-style files is described here.)

Timeline for d1ldya1: