Lineage for d3iapc4 (3iap C:626-730)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2036362Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2036363Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2036364Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 2036378Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 2036488Domain d3iapc4: 3iap C:626-730 [246816]
    Other proteins in same PDB: d3iapa1, d3iapa3, d3iapa5, d3iapb1, d3iapb3, d3iapb5, d3iapc1, d3iapc3, d3iapc5, d3iapd1, d3iapd3, d3iapd5
    automated match to d1jz8a2
    complexed with btb, dms, mg, na

Details for d3iapc4

PDB Entry: 3iap (more details), 2 Å

PDB Description: e. coli (lacz) beta-galactosidase (e416q)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3iapc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iapc4 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3iapc4:

Click to download the PDB-style file with coordinates for d3iapc4.
(The format of our PDB-style files is described here.)

Timeline for d3iapc4: