Lineage for d3iapb1 (3iap B:13-219)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046412Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2046413Protein beta-Galactosidase [49804] (2 species)
  7. 2046421Species Escherichia coli [TaxId:562] [49805] (42 PDB entries)
    Uniprot P00722
  8. 2046475Domain d3iapb1: 3iap B:13-219 [246808]
    Other proteins in same PDB: d3iapa2, d3iapa3, d3iapa4, d3iapa5, d3iapb2, d3iapb3, d3iapb4, d3iapb5, d3iapc2, d3iapc3, d3iapc4, d3iapc5, d3iapd2, d3iapd3, d3iapd4, d3iapd5
    automated match to d1f49a3
    complexed with btb, dms, mg, na

Details for d3iapb1

PDB Entry: 3iap (more details), 2 Å

PDB Description: e. coli (lacz) beta-galactosidase (e416q)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3iapb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iapb1 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3iapb1:

Click to download the PDB-style file with coordinates for d3iapb1.
(The format of our PDB-style files is described here.)

Timeline for d3iapb1: