Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.307: Nqo5-like [143242] (1 superfamily) core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel |
Superfamily d.307.1: Nqo5-like [143243] (1 family) |
Family d.307.1.1: Nqo5-like [143244] (2 proteins) Globular region is covered by PfamB PB121908 from N-end and then by PfamB PB000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329 |
Protein automated matches [254685] (1 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255883] (3 PDB entries) |
Domain d3i9ve_: 3i9v E: [246773] Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9vf_, d3i9vg_, d3i9vh_ automated match to d2fug51 complexed with ca, fes, fmn, mn, sf4 |
PDB Entry: 3i9v (more details), 3.1 Å
SCOPe Domain Sequences for d3i9ve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i9ve_ d.307.1.1 (E:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg ltfykggsrkgyrslw
Timeline for d3i9ve_: