Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end |
Family a.29.12.0: automated matches [254298] (1 protein) not a true family |
Protein automated matches [254684] (1 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255882] (3 PDB entries) |
Domain d3i9va3: 3i9v A:334-438 [246766] Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_ automated match to d2fug11 complexed with ca, fes, fmn, mn, sf4 |
PDB Entry: 3i9v (more details), 3.1 Å
SCOPe Domain Sequences for d3i9va3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i9va3 a.29.12.0 (A:334-438) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr
Timeline for d3i9va3: