Lineage for d3i9v32 (3i9v 3:96-246)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650134Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1650467Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. 1650468Protein automated matches [229599] (2 species)
    not a true protein
  7. 1650472Species Thermus thermophilus HB8 [TaxId:300852] [255889] (3 PDB entries)
  8. 1650475Domain d3i9v32: 3i9v 3:96-246 [246756]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
    automated match to d2fug34
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9v32

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (3:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3i9v32:

Sequence, based on SEQRES records: (download)

>d3i9v32 d.58.1.0 (3:96-246) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyyqkgplelpvyt
rfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmd
fglpsgfsgnitdicpvgalldltarfrarn

Sequence, based on observed residues (ATOM records): (download)

>d3i9v32 d.58.1.0 (3:96-246) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyelpvytrfeftr
rhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmdfglpsg
fsgnitdicpvgalldltarfrarn

SCOPe Domain Coordinates for d3i9v32:

Click to download the PDB-style file with coordinates for d3i9v32.
(The format of our PDB-style files is described here.)

Timeline for d3i9v32: