Lineage for d3h1hc2 (3h1h C:262-380)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959225Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1959226Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 1959290Family f.32.1.0: automated matches [254197] (1 protein)
    not a true family
  6. 1959291Protein automated matches [254431] (4 species)
    not a true protein
  7. 1959294Species Chicken (Gallus gallus) [TaxId:9031] [255857] (4 PDB entries)
  8. 1959297Domain d3h1hc2: 3h1h C:262-380 [246419]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
    automated match to d3l75c2
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hc2

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3h1hc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1hc2 f.32.1.0 (C:262-380) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3h1hc2:

Click to download the PDB-style file with coordinates for d3h1hc2.
(The format of our PDB-style files is described here.)

Timeline for d3h1hc2: