Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) |
Family f.32.1.0: automated matches [254197] (1 protein) not a true family |
Protein automated matches [254431] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [255857] (4 PDB entries) |
Domain d3h1hc2: 3h1h C:262-380 [246419] Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ automated match to d3l75c2 complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq |
PDB Entry: 3h1h (more details), 3.16 Å
SCOPe Domain Sequences for d3h1hc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1hc2 f.32.1.0 (C:262-380) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny
Timeline for d3h1hc2:
View in 3D Domains from other chains: (mouse over for more information) d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ |