Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (23 species) |
Species Dog (Canis familiaris) [TaxId:9615] [189534] (2 PDB entries) |
Domain d3gouc_: 3gou C: [246331] Other proteins in same PDB: d3goub_, d3goud_ automated match to d3pela_ complexed with hem |
PDB Entry: 3gou (more details), 3 Å
SCOPe Domain Sequences for d3gouc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gouc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Dog (Canis familiaris) [TaxId: 9615]} vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa vhasldkffaavstvltskyr
Timeline for d3gouc_: