Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Dog (Canis familiaris) [TaxId:9615] [158218] (3 PDB entries) |
Domain d3goub_: 3gou B: [246330] Other proteins in same PDB: d3goua_, d3gouc_ automated match to d3pelb_ complexed with hem |
PDB Entry: 3gou (more details), 3 Å
SCOPe Domain Sequences for d3goub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3goub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Dog (Canis familiaris) [TaxId: 9615]} vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk eftpqvqaayqkvvagvanalahkyh
Timeline for d3goub_: