Lineage for d3gisy1 (3gis Y:348-387)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961820Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 1961821Protein automated matches [226968] (3 species)
    not a true protein
  7. 1961822Species Human (Homo sapiens) [TaxId:9606] [225423] (24 PDB entries)
  8. 1961842Domain d3gisy1: 3gis Y:348-387 [246319]
    automated match to d1dx5i1
    complexed with ca, so4

Details for d3gisy1

PDB Entry: 3gis (more details), 2.4 Å

PDB Description: crystal structure of na-free thrombin in complex with thrombomodulin
PDB Compounds: (Y:) thrombomodulin

SCOPe Domain Sequences for d3gisy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gisy1 g.3.11.0 (Y:348-387) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpcfranceyqcqplnqtsylcvcaegfapiphephrcq

SCOPe Domain Coordinates for d3gisy1:

Click to download the PDB-style file with coordinates for d3gisy1.
(The format of our PDB-style files is described here.)

Timeline for d3gisy1: