Lineage for d3g0aa1 (3g0a A:3-257)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594378Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2594379Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2594494Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2594495Protein automated matches [190734] (14 species)
    not a true protein
  7. 2594503Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)
  8. 2594521Domain d3g0aa1: 3g0a A:3-257 [246223]
    Other proteins in same PDB: d3g0aa2
    automated match to d3fzia_
    complexed with gol, mn, po4

Details for d3g0aa1

PDB Entry: 3g0a (more details), 2.6 Å

PDB Description: mth0212 with two bound manganese ions
PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d3g0aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0aa1 d.151.1.0 (A:3-257) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
vlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfftp
aerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseerl
kyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawid
kfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswilsd
vmgsdhcpigleiel

SCOPe Domain Coordinates for d3g0aa1:

Click to download the PDB-style file with coordinates for d3g0aa1.
(The format of our PDB-style files is described here.)

Timeline for d3g0aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g0aa2