SCOPe 2.06: Domain d3g0aa1: 3g0a A:3-257

Lineage for d3g0aa1 (3g0a A:3-257)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (12 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)

8. Domain d3g0aa1: 3g0a A:3-257 [246223]
   Other proteins in same PDB: d3g0aa2
   automated match to d3fzia_
   complexed with gol, mn, po4

Details for d3g0aa1

PDB Entry: 3g0a, 2.6 Å

PDB Description: mth0212 with two bound manganese ions

PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d3g0aa1:

Sequence; same for both SEQRES and ATOM records:

>d3g0aa1 d.151.1.0 (A:3-257) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
vlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfftp
aerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseerl
kyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawid
kfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswilsd
vmgsdhcpigleiel

Timeline for d3g0aa1:

• d3g0aa1 first appeared in SCOPe 2.04, called d3g0aa_
  
• d3g0aa1 was called d3g0aa_ in SCOPe 2.05
  
• d3g0aa1 appears in SCOPe 2.07
  
• d3g0aa1 appears in the current release, SCOPe 2.08