Lineage for d3fzia_ (3fzi A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934223Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1934224Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1934333Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 1934334Protein automated matches [190734] (8 species)
    not a true protein
  7. 1934338Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)
  8. 1934343Domain d3fzia_: 3fzi A: [232214]
    automated match to d2jc5a_
    complexed with mg

Details for d3fzia_

PDB Entry: 3fzi (more details), 1.9 Å

PDB Description: 1.9 angstrom structure of the thermophilic exonuclease iii homologue mth0212
PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d3fzia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fzia_ d.151.1.0 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
dvmgsdhcpigleielle

SCOPe Domain Coordinates for d3fzia_:

Click to download the PDB-style file with coordinates for d3fzia_.
(The format of our PDB-style files is described here.)

Timeline for d3fzia_: