Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
Protein automated matches [190734] (8 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries) |
Domain d3fzia_: 3fzi A: [232214] automated match to d2jc5a_ complexed with mg |
PDB Entry: 3fzi (more details), 1.9 Å
SCOPe Domain Sequences for d3fzia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fzia_ d.151.1.0 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils dvmgsdhcpigleielle
Timeline for d3fzia_: