Lineage for d3eo1d2 (3eo1 D:108-215)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518539Domain d3eo1d2: 3eo1 D:108-215 [245889]
    Other proteins in same PDB: d3eo1a1, d3eo1c_, d3eo1d1, d3eo1f_, d3eo1g1, d3eo1i_, d3eo1j1, d3eo1l_
    automated match to d1dn0a2

Details for d3eo1d2

PDB Entry: 3eo1 (more details), 3.1 Å

PDB Description: Structure of the Fab Fragment of GC-1008 in Complex with Transforming Growth Factor-Beta 3
PDB Compounds: (D:) GC-1008 Fab Light Chain

SCOPe Domain Sequences for d3eo1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eo1d2 b.1.1.2 (D:108-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d3eo1d2:

Click to download the PDB-style file with coordinates for d3eo1d2.
(The format of our PDB-style files is described here.)

Timeline for d3eo1d2: