Lineage for d3enea2 (3ene A:357-522)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1775884Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1775885Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 1775908Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 1775909Species Human (Homo sapiens) [TaxId:9606] [49572] (57 PDB entries)
  8. 1775919Domain d3enea2: 3ene A:357-522 [245882]
    Other proteins in same PDB: d3enea1, d3enea3, d3enea4
    automated match to d1e8wa2
    complexed with npz

Details for d3enea2

PDB Entry: 3ene (more details), 2.4 Å

PDB Description: Complex of PI3K gamma with an inhibitor
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3enea2:

Sequence, based on SEQRES records: (download)

>d3enea2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvrllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d3enea2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycrllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsat
npdkensmsisilldn

SCOPe Domain Coordinates for d3enea2:

Click to download the PDB-style file with coordinates for d3enea2.
(The format of our PDB-style files is described here.)

Timeline for d3enea2: