Lineage for d3enea1 (3ene A:144-321)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893599Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 1893619Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 1893620Species Human (Homo sapiens) [TaxId:9606] [54276] (58 PDB entries)
  8. 1893630Domain d3enea1: 3ene A:144-321 [245881]
    Other proteins in same PDB: d3enea2, d3enea3, d3enea4
    automated match to d1e7ua3
    complexed with npz

Details for d3enea1

PDB Entry: 3ene (more details), 2.4 Å

PDB Description: Complex of PI3K gamma with an inhibitor
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3enea1:

Sequence, based on SEQRES records: (download)

>d3enea1 d.15.1.5 (A:144-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d3enea1 d.15.1.5 (A:144-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakqdfvlrvcg
rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d3enea1:

Click to download the PDB-style file with coordinates for d3enea1.
(The format of our PDB-style files is described here.)

Timeline for d3enea1: