SCOPe 2.07: Domain d2zxba2: 2zxb A:357-447

Lineage for d2zxba2 (2zxb A:357-447)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries)

8. Domain d2zxba2: 2zxb A:357-447 [245041]
   Other proteins in same PDB: d2zxba1, d2zxba3, d2zxbb1, d2zxbb3
   automated match to d2zwyb2
   complexed with zxb

Details for d2zxba2

PDB Entry: 2zxb, 2.61 Å

PDB Description: alpha-l-fucosidase complexed with inhibitor, ph-6fnj

PDB Compounds: (A:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zxba2:

Sequence; same for both SEQRES and ATOM records:

>d2zxba2 b.71.1.0 (A:357-447) automated matches {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

Timeline for d2zxba2:

• d2zxba2 first appeared in SCOPe 2.04
  
• d2zxba2 appears in SCOPe 2.06
  
• d2zxba2 appears in the current release, SCOPe 2.08