Lineage for d2zxbb2 (2zxb B:357-447)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420664Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries)
  8. 2420680Domain d2zxbb2: 2zxb B:357-447 [245043]
    Other proteins in same PDB: d2zxba1, d2zxba3, d2zxbb1, d2zxbb3
    automated match to d2zwyb2
    complexed with zxb

Details for d2zxbb2

PDB Entry: 2zxb (more details), 2.61 Å

PDB Description: alpha-l-fucosidase complexed with inhibitor, ph-6fnj
PDB Compounds: (B:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zxbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxbb2 b.71.1.0 (B:357-447) automated matches {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

SCOPe Domain Coordinates for d2zxbb2:

Click to download the PDB-style file with coordinates for d2zxbb2.
(The format of our PDB-style files is described here.)

Timeline for d2zxbb2: