Lineage for d2zxba1 (2zxb A:7-356)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440883Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 proteins)
    glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases
    automatically mapped to Pfam PF01120
  6. 2440892Protein automated matches [231482] (2 species)
    not a true protein
  7. 2440893Species Thermotoga maritima [TaxId:2336] [231744] (10 PDB entries)
  8. 2440908Domain d2zxba1: 2zxb A:7-356 [245040]
    Other proteins in same PDB: d2zxba2, d2zxba3, d2zxbb2, d2zxbb3
    automated match to d2zwyb1
    complexed with zxb

Details for d2zxba1

PDB Entry: 2zxb (more details), 2.61 Å

PDB Description: alpha-l-fucosidase complexed with inhibitor, ph-6fnj
PDB Compounds: (A:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zxba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxba1 c.1.8.11 (A:7-356) automated matches {Thermotoga maritima [TaxId: 2336]}
rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae
wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt
khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir
ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh
pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq
lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy

SCOPe Domain Coordinates for d2zxba1:

Click to download the PDB-style file with coordinates for d2zxba1.
(The format of our PDB-style files is described here.)

Timeline for d2zxba1: