![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) ![]() |
![]() | Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins) |
![]() | Protein automated matches [254660] (1 species) not a true protein |
![]() | Species Nostoc sp. [TaxId:103690] [255734] (2 PDB entries) |
![]() | Domain d2zt9f_: 2zt9 F: [244987] Other proteins in same PDB: d2zt9a_, d2zt9b_, d2zt9h_ automated match to d1vf5s_ complexed with bcr, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2zt9 (more details), 3 Å
SCOPe Domain Sequences for d2zt9f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zt9f_ f.23.25.1 (F:) automated matches {Nostoc sp. [TaxId: 103690]} msgellnaallsfglifvgwalgalllkiqga
Timeline for d2zt9f_: