Lineage for d2zt9f_ (2zt9 F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026305Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 3026306Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)
  6. 3026323Protein automated matches [254660] (1 species)
    not a true protein
  7. 3026324Species Nostoc sp. [TaxId:103690] [255734] (2 PDB entries)
  8. 3026326Domain d2zt9f_: 2zt9 F: [244987]
    Other proteins in same PDB: d2zt9a_, d2zt9b_, d2zt9h_
    automated match to d1vf5s_
    complexed with bcr, cla, fes, hem, opc, sqd, umq

Details for d2zt9f_

PDB Entry: 2zt9 (more details), 3 Å

PDB Description: crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d2zt9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zt9f_ f.23.25.1 (F:) automated matches {Nostoc sp. [TaxId: 103690]}
msgellnaallsfglifvgwalgalllkiqga

SCOPe Domain Coordinates for d2zt9f_:

Click to download the PDB-style file with coordinates for d2zt9f_.
(The format of our PDB-style files is described here.)

Timeline for d2zt9f_: