Lineage for d2zdxb2 (2zdx B:188-396)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580554Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2580555Protein automated matches [226867] (21 species)
    not a true protein
  7. 2580636Species Human (Homo sapiens) [TaxId:9606] [225008] (14 PDB entries)
  8. 2580655Domain d2zdxb2: 2zdx B:188-396 [244911]
    Other proteins in same PDB: d2zdxa1, d2zdxb1
    automated match to d2e0ab2
    complexed with p4a

Details for d2zdxb2

PDB Entry: 2zdx (more details), 2.54 Å

PDB Description: Inhibitor-bound structures of human pyruvate dehydrogenase kinase 4
PDB Compounds: (B:) Pyruvate dehydrogenase kinase isozyme 4

SCOPe Domain Sequences for d2zdxb2:

Sequence, based on SEQRES records: (download)

>d2zdxb2 d.122.1.0 (B:188-396) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh
lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf
sytystaptpvmdnsrnaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkal
ssesieklpvfnksafkhyqmsseaddwc

Sequence, based on observed residues (ATOM records): (download)

>d2zdxb2 d.122.1.0 (B:188-396) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh
lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf
syyglpisrlyakyfqgdlnlyslsgygtdaiiylkalssesieklpvfnksafkhdwc

SCOPe Domain Coordinates for d2zdxb2:

Click to download the PDB-style file with coordinates for d2zdxb2.
(The format of our PDB-style files is described here.)

Timeline for d2zdxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zdxb1