Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225008] (12 PDB entries) |
Domain d2zdxb2: 2zdx B:188-396 [244911] Other proteins in same PDB: d2zdxa1, d2zdxb1 automated match to d2e0ab2 complexed with p4a |
PDB Entry: 2zdx (more details), 2.54 Å
SCOPe Domain Sequences for d2zdxb2:
Sequence, based on SEQRES records: (download)
>d2zdxb2 d.122.1.0 (B:188-396) automated matches {Human (Homo sapiens) [TaxId: 9606]} pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf sytystaptpvmdnsrnaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkal ssesieklpvfnksafkhyqmsseaddwc
>d2zdxb2 d.122.1.0 (B:188-396) automated matches {Human (Homo sapiens) [TaxId: 9606]} pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf syyglpisrlyakyfqgdlnlyslsgygtdaiiylkalssesieklpvfnksafkhdwc
Timeline for d2zdxb2: