Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225008] (14 PDB entries) |
Domain d2e0ab2: 2e0a B:188-386 [230682] Other proteins in same PDB: d2e0aa1, d2e0ab1 automated match to d1jm6a2 complexed with anp, mg |
PDB Entry: 2e0a (more details), 1.86 Å
SCOPe Domain Sequences for d2e0ab2:
Sequence, based on SEQRES records: (download)
>d2e0ab2 d.122.1.0 (B:188-386) automated matches {Human (Homo sapiens) [TaxId: 9606]} pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf sytystaptpvmdnsrnaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkal ssesieklpvfnksafkhy
>d2e0ab2 d.122.1.0 (B:188-386) automated matches {Human (Homo sapiens) [TaxId: 9606]} pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf sytystaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkalssesieklpvf nksafkhy
Timeline for d2e0ab2: