Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
Protein GMP synthetase [52319] (2 species) |
Species Thermus thermophilus HB8 [TaxId:300852] [255715] (2 PDB entries) |
Domain d2ywba1: 2ywb A:1-189 [244844] Other proteins in same PDB: d2ywba2, d2ywba3, d2ywbb2, d2ywbb3, d2ywbc2, d2ywbc3, d2ywbd2, d2ywbd3 automated match to d1gpma2 |
PDB Entry: 2ywb (more details), 2.1 Å
SCOPe Domain Sequences for d2ywba1:
Sequence, based on SEQRES records: (download)
>d2ywba1 c.23.16.1 (A:1-189) GMP synthetase {Thermus thermophilus HB8 [TaxId: 300852]} mvlvldfgsqytrliarrlrelrafslilpgdapleevlkhrpqalilsggprsvfdpda prpdprlfssglpllgicygmqllaqelggrveragraeygkalltrhegplfrglegev qvwmshqdavtapppgwrvvaeteenpvaaiaspdgraygvqfhpevahtpkgmqilenf lelagvkrd
>d2ywba1 c.23.16.1 (A:1-189) GMP synthetase {Thermus thermophilus HB8 [TaxId: 300852]} mvlvldfgsqytrliarrlrelrafslilpgdapleevlkhrpqalilsggprsvfdpda prpdprlfssglpllgicygmqllaqelggrveraeygkalltrhegplfrglegevqvw mshqdavtapppgwrvvaeteenpvaaiaspdgraygvqfhpevahtpkgmqilenflel agvkrd
Timeline for d2ywba1: