SCOPe 2.08: Domain d2ywbb2: 2ywb B:190-382

Lineage for d2ywbb2 (2ywb B:190-382)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein GMP synthetase, central domain [52404] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [255716] (2 PDB entries)

8. Domain d2ywbb2: 2ywb B:190-382 [244848]
   Other proteins in same PDB: d2ywba1, d2ywba3, d2ywbb1, d2ywbb3, d2ywbc1, d2ywbc3, d2ywbd1, d2ywbd3
   automated match to d1gpma1

Details for d2ywbb2

PDB Entry: 2ywb, 2.1 Å

PDB Description: Crystal structure of GMP synthetase from Thermus thermophilus

PDB Compounds: (B:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d2ywbb2:

Sequence, based on SEQRES records:

>d2ywbb2 c.26.2.1 (B:190-382) GMP synthetase, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
wtpehvleellrevreragkdrvllavsggvdsstlalllakagvdhlavfvdhgllrlg
ereevegalralgvnllvvdakerflkalkgvedpeekrkiigrefvaafsqvarergpf
rflaqgtlypdviesagghgaakikshhnvgglpedlefellepfrllfkdevrelalll
glpdtlrlrhpfp

Sequence, based on observed residues (ATOM records):

>d2ywbb2 c.26.2.1 (B:190-382) GMP synthetase, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
wtpehvleellrevreragkdrvllavsggvdsstlalllakagvdhlavfvdhgllrlg
ereevegalralgvnllvvdakerflkalkgvedpeekrkiigrefvaafsqvarergpf
rflaqgtlypdviefellepfrllfkdevrelalllglpdtlrlrhpfp

Timeline for d2ywbb2:

• d2ywbb2 first appeared in SCOPe 2.04
  
• d2ywbb2 appears in SCOPe 2.07