SCOPe 2.05: Domain d2xgba_: 2xgb A:

Lineage for d2xgba_ (2xgb A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (22 species)
   not a true protein

7. Species Barley (Hordeum vulgare) [TaxId:4513] [255684] (8 PDB entries)

8. Domain d2xgba_: 2xgb A: [244501]
   automated match to d1b1ya_
   complexed with edo, epg

Details for d2xgba_

PDB Entry: 2xgb, 1.2 Å

PDB Description: crystal structure of barley beta-amylase complexed with 2,3- epoxypropyl-alpha-d-glucopyranoside

PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d2xgba_:

Sequence; same for both SEQRES and ATOM records:

>d2xgba_ c.1.8.1 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
nvkgnyvqvyvmlpldavsvnnrfekgdelraqlrklveagvdgvmvdvwwglvegkgpk
aydwsaykqlfelvqkaglklqaimsfhqcggnvgdavnipipqwvrdvgtrdpdifytd
ghgtrnieyltlgvdnqplfhgrsavqmyadymtsfrenmkefldagvivdievglgpag
emrypsypqshgwsfpgigeficydkylqadfkaaaaavghpewefpndvgqyndtpert
qffrdngtylsekgrfflawysnnlikhgdrildeankvflgykvqlaikisgihwwykv
pshaaeltagyynlhdrdgyrtiarmlkrhrasinftcaemrdseqssqamsapeelvqq
vlsagwreglnvacenalprydptayntilrnarphginqsgppehklfgftylrlsnql
vegqnyanfktfvdrmhanlprdpyvdpmaplprsgpeisiemilqaaqpklqpfpfqeh
tdlpvg

Timeline for d2xgba_:

• d2xgba_ first appeared in SCOPe 2.04
  
• d2xgba_ appears in SCOPe 2.06
  
• d2xgba_ appears in the current release, SCOPe 2.08