SCOPe 2.05: Domain d2rr8a_: 2rr8 A:

Lineage for d2rr8a_ (2rr8 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (26 PDB entries)

8. Domain d2rr8a_: 2rr8 A: [243754]
   automated match to d1p5sa_

Details for d2rr8a_

PDB Entry: 2rr8

PDB Description: solution structure of calponin homology domain of iqgap1

PDB Compounds: (A:) IQGAP1 protein

SCOPe Domain Sequences for d2rr8a_:

Sequence; same for both SEQRES and ATOM records:

>d2rr8a_ a.40.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgsltaeemderrrqnvayeylchleeakrwmeaclgedlpptteleeglrngvylak
lgnffspkvvslkkiydreqtrykatglhfrhtdnviqwlnamdeiglpkifypettdiy
drknmprciycihalslylfklglapqiqdlygkvdfteeeinnmktelekygiqmpafs
kiggilanel

Timeline for d2rr8a_:

• d2rr8a_ first appeared in SCOPe 2.04
  
• d2rr8a_ is called d2rr8a1 in SCOPe 2.06
  
• d2rr8a_ appears in the current release, SCOPe 2.08, called d2rr8a1