PDB entry 2rr8

View 2rr8 on RCSB PDB site
Description: Solution structure of calponin homology domain of IQGAP1
Class: protein binding
Keywords: F-actin binding protein, PROTEIN BINDING
Deposited on 2010-06-09, released 2010-09-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IQGAP1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IQGAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P1N4 (5-189)
      • expression tag (0-4)
    Domains in SCOPe 2.05: d2rr8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rr8A (A:)
    gplgsltaeemderrrqnvayeylchleeakrwmeaclgedlpptteleeglrngvylak
    lgnffspkvvslkkiydreqtrykatglhfrhtdnviqwlnamdeiglpkifypettdiy
    drknmprciycihalslylfklglapqiqdlygkvdfteeeinnmktelekygiqmpafs
    kiggilanel